EXPORTING YOUR FILM from ADOBE PP6

A.  
i. How do you export?
    You go to 'File', 'Export' then 'Media' and then change the file types.
  
ii. Where do you export to?
    You export to your media folder.

iii. How do you name your folder? Why is this important?
     First you go to 'file', 'export', 'media' and then click on the yellow writing saying 'sequence 01.mp4'. It is important because if you name the file the same as other ones you may get confused with the other files so it might get lost.

iv. What are the different formats? mp4, mov, avi, wmv, flv- explain, discussing file size, resolution/quality and purpose- where will it be used and why is that important?
     All the files have different file sizes so if you cannot send it because it is a large file you can change the file type for it all to fit and will be able to send.

CONVERTING and CLIPPING your video using MPEG STREAMCLIP.

B.
i.How do you import your film?
 You go to 'file' 'import', your file and choose what you want to import.

ii. Which formats can you choose- why is this important?
   mp4, mov, avi, flv, and wmv. It is mportant because because all of the file types have different file sizes so you can make the file size smaller to send over email or text etc.

iii. How do you name your files and WHY is this important?
     When you first open ADOBE PP6, click 'file' then 'new' and you can adjust your file name from there. It is important because if you name the file the same as other ones you may get confused with the other files so it might get lost.

iv. Why is converting so useful?
     Converting files is useful because the file can be used by different programs. For example you could pull a video off a DVD but iTunes wouldnt be able to play that video unless it was enoded  in the correct file type.
 v. Why is clipping so useful?
    Clipping is useful because you can chop down your movie and your file to make it shorter. it also alows you to put two different files together which have been shot from different angles and made to look like they was shot at the same time.

Uploading video to YOUTUBE.

C.
i. what is the account name and password- where did you find this information?
   The account name is "COOMBEMEDIASTUDENT". The username/email is coombemediastudent@gmail.com and the password is Miss Thrashers name followed by the room number.
ii. How do you name and tag/label your video (for searching)
     Once you have uploaded your video , you then go to info and settings and at the bottom there will be a section called tags.
iii. How do you annotate a video?
      First of all you need to upload your video to youtube. when you have processed and published it, you then need to go to the video where it is uploaded to.At the bottom of the video, there will be 5 options, you go to the one that says "annotations" and from there, you can annotate you video how you want.
      

                                       Question sheet:

1)
i What are pixel dimensions?
Pixel dimensions are the digital resolution of a television or a computer screen.It is also the number of pixels wide and the number of pixels tall of a sensor; for example 1024x768.

ii. What is DPI resolution (dots per inch)?
DPI is the number of individual dots that can be placed in a line within the length of 1 inch (2.54cm).

iii. What is quality (of an image)?
 The quality of an image measures the perceived image degradation. Imaging systems may introduce some amounts of distortion or artifacts in the signal, so the quality assessment is an important problem.

iv.  What is compression settings?
When compression settings are used in photography, it is used to shrink the size of the photo, for example: if you want to send an image by email on your smartphone, a message will pop up asking you what size you would like to send your image, if you click small then that is what compressing is.

2)
i. What is a bitmap/raster?
Bitmaps and raster images are composed of dots or pixels. Their potential for scaling up for large format output is limited.

ii. What is vector?
 A vector is a software and hardware that use geometrical formulas to represent images.

iii. What is the difference between a bitmap/raster and a vector?
 Vector images are more flexible than bit maps because they can be resized and stretched. In addition,  images store as vectors look better on devices like monitors and printers with higher resolution, where as bitmapped images always appear the same regardless of a device's resolution.

                      
 Coldplay - Yellow.

fgpweifwapig`sihfgweadigpeirgpaigyvgpigpiyvgpiydffgsgdapiugadpizdhfgafgyfgoeyfgoyfgs
sufhspufgsapfygdsaygosyzgvpiudpewyugfdp`iysfpi`gw`RPRRARPWIUGFPUG`EPYFG`P
gsyigfpwayrgfpasgfpairgpuagprwiugsizugpsuigfpsiugfpsaufgpzivzx;jch;dhgpserugpaushfvp
hvg`sfgpsryfg`paegfyzgsfpfepigpy`idgf`pyfgspszgfpsygp`sgp`sgo`ysdg`psdfgpxdgvos`gszoghg.